PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593376.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 459aa    MW: 51678.7 Da    PI: 6.7905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593376.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-142468348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W++eEd++l + ++ +G+++W+ Ia+++   +t  qc+ rw++yl
   XP_009593376.1 24 SWSQEEDDILREQIRIHGTDNWTIIASKFK-DKTTRQCRRRWFTYL 68
                     6****************************9.*************97 PP

2Myb_DNA-binding43.95.3e-1474117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
   XP_009593376.1  74 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 117
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0571768IPR017930Myb domain
SMARTSM007174.7E-132170IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2622115IPR009057Homeodomain-like
CDDcd001671.36E-122468No hitNo description
Gene3DG3DSA:1.10.10.603.0E-202575IPR009057Homeodomain-like
PfamPF139218.3E-152585No hitNo description
PROSITE profilePS5129420.11269123IPR017930Myb domain
SMARTSM007174.3E-1573121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2076122IPR009057Homeodomain-like
CDDcd001675.13E-1177118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MQQNMKKSSN SGEAAKPKER HIVSWSQEED DILREQIRIH GTDNWTIIAS KFKDKTTRQC  60
RRRWFTYLNS DFKKGGWSPE EDMLLCEAQK IFGNRWTEIA KVVSGRTDNA VKNRFTTLCK  120
KRAKHEALAK ENSNSFVNLN NKRVIFPDGL NIDRITEAAA PFKKLRTSHI SDVRQNCDSG  180
EKSFGDCGTT HPLLRHPFAV LAQNFRNAGK NLTSHQQTTE NDNKTQGTFL KKDDPKVQAL  240
MQQAELLSSL AMKVNTENTD QSLENAWKIL QDFLHQTKEG DMLKFQIPEM NLGPNDYKDL  300
IADSKSSNEG SRPSWRQPAL SEDSAGSSEY STGSTLLSHA LADKTEESQA EVCAHHQDIE  360
SELRTSQLSD QDTLPVRGEE KVNDGPATAE CEFLDTDFTS PLQVTPLFRS LAAEIPTPKF  420
SESERQFLLK TLGVESTSPY PGTNLTQPPS CKRALLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-272512310108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1352886e-67AC135288.1 Solanum demissum chromosome 5 BAC PGEC219 genomic sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593376.10.0PREDICTED: uncharacterized protein LOC104090044
RefseqXP_009593377.10.0PREDICTED: uncharacterized protein LOC104090044
RefseqXP_009593378.10.0PREDICTED: uncharacterized protein LOC104090044
RefseqXP_016470110.10.0PREDICTED: uncharacterized protein LOC107792411
RefseqXP_016470111.10.0PREDICTED: uncharacterized protein LOC107792411
RefseqXP_016470112.10.0PREDICTED: uncharacterized protein LOC107792411
TrEMBLK4BWP20.0K4BWP2_SOLLC; Uncharacterized protein
TrEMBLQ6L4J60.0Q6L4J6_SOLDE; Putative Myb-like DNA-binding protein
STRINGSolyc05g007160.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41242134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-176MYB family protein